DPCstruct | MC55615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 184 ± 33 aa |
| Standard deviation of domain lengths | 33.38 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 92.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.88 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0059- PF20736 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V4H6Y9 | 2-154 | WAATENGTIRERMSAVVDALDECQKKIGTGYLSAFSTEEFDLYEEVKAVWAPYYTIHKILAGLVDQYLFGTNAKALDMAIWMAEYFG… |
| A0A5B9DXX8 | 149-322 | YASDGDTLLKQRADALVAELAACQQPNGYLSAFPESFFDRLSNGQKVWAPFYTIHKIQAGLLDMYRHTGNQQALNVATGIGDWVVRW… |
| A0A6F8Y0F8 | 133-331 | None |
| A0A0G2HAF4 | 400-642 | None |
| M0VCF8 | 1-181 | None |
| A0A1D6P4W1 | 1-181 | None |
| A0A287XEA5 | 1-147 | None |
| A0A453SKX0 | 168-355 | None |
| A0A0M0K576 | 184-381 | None |
| A0A350V706 | 94-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.