DPCstruct | MC5561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 262 ± 64 aa |
| Standard deviation of domain lengths | 64.37 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 81.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P9B6F2 | 114-288 | MWAGLWQKRCKFPETATAIAYEQHGFFEQAQETYEKAMEKAKKEHERNNASPAIFPEYQLWEDHWIRCSKELNQWEALTEYGQSKGH… |
| A0A811XBM7 | 60-265 | KHARYRETNVAIAYEQQGFFEQAQAAYDVAMGKLKTEYTANPSSYNMHKECKLWTEHWLKCAKELNQWDSLLELGLSRNCRDPFLIL… |
| A0A7J8M7N9 | 521-859 | None |
| A0A1A9ZHQ0 | 4-202 | None |
| A0A7J7IP05 | 295-642 | None |
| A0A7R9B0H6 | 500-732 | None |
| A0A819N763 | 542-876 | None |
| A0A2S5BGK9 | 469-814 | None |
| A0A3P6S9J3 | 72-355 | None |
| A0A3M7PWN7 | 174-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.