DPCstruct | MC55603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 135 ± 10 aa |
| Standard deviation of domain lengths | 9.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A024UXU6 | 101-238 | FARLLPLLAAHVALAVVTFSPQVPLIREVLSLCFGPTVSESIIVRGDVEGWTVSQDDAVQFTGIDGHHLLLHRRTKLPYVASAALEA… |
| A0A7I8V3S6 | 1-147 | MKELLSAALESSLHVCIVTFSEQFKLIEDLMASAFTKYNYKKILLRCNTKHWPRGEEGHGPLPQIAMMTLGKEQHLSWVVTQLYQTH… |
| A0A815GPE4 | 89-218 | None |
| A0A816VSL3 | 344-471 | None |
| T1F0B4 | 60-198 | None |
| A0A6G0XHC8 | 77-230 | None |
| A0A2R5GNE9 | 723-863 | None |
| A0A6A5ADK9 | 71-208 | None |
| A0A835YYJ4 | 47-165 | None |
| A0A7S1ZBU2 | 119-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.