DPCstruct | MC55601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 279 ± 45 aa |
| Standard deviation of domain lengths | 44.59 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3TRH4 | 28-297 | EEAAEAERQQRAERAAELAAANVGHVDAFRDEMLAEGGGDVGKLRQHASLLPLAQEFQAALNEAIDEYVATALEIGGLKREELSTFS… |
| A0A7M3RD88 | 146-412 | KEKTSNEEENTRLNEKYREAFVDGLENDKLFLSVFTDSADTILPQLPGCSTIVERFKMKIISTSEELFNYGIREKSERDAEIENATF… |
| A0A1V9Z3N9 | 198-521 | None |
| A0A2J7ZQ90 | 88-357 | None |
| S9UFR5 | 46-374 | None |
| A0A812ANX3 | 197-425 | None |
| A0A2J7PJS6 | 86-443 | None |
| A0A0N1I6R4 | 23-236 | None |
| A0A7R9P2L6 | 35-299 | None |
| A0A7S0DN88 | 40-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.