DPCstruct | MC5560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 156 ± 24 aa |
| Standard deviation of domain lengths | 24.28 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.29 |
| Pfam Score | 92.42 |
| Assigned Pfam label(s) | PF18940- CL0604- CL0671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8WTZ3 | 14-183 | KNGLKADLVISALQKCIRRADEDLAMRFAYELYVTSPFHEAKMWQRLLVISVEDIGFGNPEAPILVRNLFELHKEYDYHDGDRTIFF… |
| A0A811X980 | 580-735 | EDIDKSIRAGDDNAALYWTTRALHGGEDPLYVARRLVRASAEDIGLADPNALVEAVATLQGCQQLGMPECNVLLAQCAVRLARAPKS… |
| A0A318CYW9 | 14-145 | None |
| A0A1E3NMH2 | 612-782 | None |
| U6FNL9 | 64-218 | None |
| A0A2M7AZA2 | 5-109 | None |
| A0A3S4HGR1 | 71-243 | None |
| A0A7S4PK20 | 136-304 | None |
| J5T2J0 | 275-439 | None |
| A0A0G4HKG2 | 1-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.