DPCstruct | MC556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 107 ± 9 aa |
| Standard deviation of domain lengths | 9.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D6DWK2 | 2-100 | ALRPLAHGKALAARIAAGERVGLLVVALHDWEAGRWFDGRPEVARVVLPADLPVEAASWACCLALDCVVCGSADDATFYAACAAIAD… |
| A0A4P7BXC3 | 28-146 | YTRKFPPFGKQLANRLRQGDKPSNCVWIGCGANAWSRTRHDLTRSDSAALCLPYGEDPLSYRWPVSGLDCLILHTGGLNKEALLRLG… |
| A0A127K2R0 | 117-218 | None |
| A0A6I3XHU2 | 2-102 | None |
| A0A2T4IF64 | 1-91 | None |
| A0A126Z9D8 | 4-103 | None |
| H8GLQ3 | 26-128 | None |
| A0A2T5K3H3 | 28-134 | None |
| A0A838LX55 | 83-194 | None |
| A0A7U4RKV8 | 2-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.