DPCstruct | MC55597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 164 ± 28 aa |
| Standard deviation of domain lengths | 28.00 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10498 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3T8J2 | 15-157 | AFLMMDDILERLKMLDYELAFRGFTRLTHTYFAMPAPNPNEQFHYFMALCSWLMGLLGSAWQAPSQSDDPNLAAQSLHSQLQQVGAP… |
| A0A7J7KIY4 | 6-131 | MEGIIEKLKLLDYEKLFCQELGFKPFSRHYFAIPTNPGEQFYNFTSLCAWLLRLCGKNFDPPQEYDDPNATISSILLELKSLGQNVN… |
| A0A1W0A3K6 | 583-758 | None |
| A0A0L0SAY9 | 2-170 | None |
| A0BMR0 | 287-434 | None |
| A0A674HR09 | 21-197 | None |
| A0A2A9M6B0 | 35-165 | None |
| A0A482SVM2 | 3-131 | None |
| A0A830HSB9 | 2-179 | None |
| A0A7S4DLH3 | 32-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.