DPCstruct | MC55596
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 221 ± 39 aa |
| Standard deviation of domain lengths | 39.26 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 36.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3T1F0 | 299-537 | AVCEAVFSPESKFWRLWGTRETWRQSAAGERQCWEQLGGDAYFERAGKATQCDVNWFEGAQGELGRVESRAHFAAPAPALLGFDGDL… |
| A0A7S0LNC8 | 32-274 | MWAAEAWGRQSADRPKCWDVFRERQGNGFPSRSAFEFFDETGRGAHCRTNWYEGNEGELGRQGRMPYFDGNAPALLGFDESIDDFCV… |
| A0A7S4HGL0 | 1-144 | None |
| A0A7S3VXT7 | 19-252 | None |
| A0A7S0L3M8 | 21-140 | None |
| A0A7S3AGG3 | 9-183 | None |
| A0A7S3F2I2 | 10-193 | None |
| A0A0G4GSC5 | 43-282 | None |
| A0A7S2CW38 | 15-255 | None |
| A0A7S4MWI7 | 124-354 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.