DPCstruct | MC55593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 196 ± 30 aa |
| Standard deviation of domain lengths | 30.05 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T4HFF2 | 8-171 | IPCGESIPFNNPHAVSVSLPTIHDIISYEEGDKKMLEKMQSGYPRFFRNKLVQRLVDYVRKKYEVTEYYLILPISSQKAYHILCELI… |
| A0A0D2IMV8 | 10-191 | GHAVPPASRHSVTVHMPTWENVERYGADSRSVIATFQNAYPRMKPHRDIACLTSAILGHLDLDNQACLLFTSLQSAQECDDYSTSPR… |
| A0A397EWR4 | 14-230 | None |
| A0A367LG32 | 331-527 | None |
| A0A4Z0YX76 | 10-200 | None |
| W6PWU0 | 1-198 | None |
| A0A0J9WJI9 | 720-933 | None |
| A0A146IMF1 | 1-195 | None |
| Q2HFC3 | 1-210 | None |
| A0A4S4LQJ3 | 452-615 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.