DPCstruct | MC55590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 102 ± 6 aa |
| Standard deviation of domain lengths | 6.38 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 70.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15998 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J1J9W5 | 1-108 | MSGKNPRPICVSPPRFDRLIEMCARFHDIYFVGRNMHLCLDVTATVGDFDLIDREFDCMKFGSDGVALVSPEDGGGHPGYPAVINPG… |
| A0A1I8NMX5 | 30-135 | VSTRNPSPFCIPIMLNIPMSMCVQMSDVGLQGDNMHACMDFMVQLASSGLFEMHFQCMQMGAQGVQWVSPTGGPVVPPSQSKLTNRS… |
| A0A7E5VUB7 | 442-541 | None |
| A0A3Q0IT39 | 54-155 | None |
| A0A3Q0JJW3 | 348-449 | None |
| A0A0E4G9T0 | 1-111 | None |
| A0A3Q0JBW7 | 1-95 | None |
| D6W7K2 | 111-217 | None |
| A0A4C1TI00 | 381-473 | None |
| A0A194PVY5 | 18-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.