DPCstruct | MC55587
Metacluster Properties and Pfam Annotations
| Number of structural domains | 448 |
|---|---|
| Mean domain length (aa) | 236 ± 56 aa |
| Standard deviation of domain lengths | 56.15 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 83.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 14.96 |
| Pfam Score | 63.91 |
| Assigned Pfam label(s) | CL0023- PF08706- PF08707- CL0022- PF08708 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C9R7L2 | 4-239 | LAEAAVCYAERFGWAVLPLHSIAGGRCTCGRVNCPSPGKHPLTQHGVKEASKDSETIAAWWRRWPWANIGVATGSISGFFVLDVDGP… |
| W5XX48 | 2-149 | RELPRWTAAAGKRPVTTDGAPASSTDAQTWTSHEEVVGGPHGVMLGGGLACIDLDHCLSARGKLAPWAREIIDAVPGAVVERSVSKR… |
| K8F3H6 | 153-332 | None |
| A0A1Q7BQZ1 | 3-314 | None |
| K6DM83 | 8-232 | None |
| A0A0P7GQE4 | 15-230 | None |
| A0A2N5YWY2 | 1-251 | None |
| B5INY9 | 21-272 | None |
| V7F0Y9 | 38-231 | None |
| A0A1G1AIV9 | 5-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.