DPCstruct | MC55583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 125 ± 8 aa |
| Standard deviation of domain lengths | 8.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 21.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A101GQT1 | 44-163 | WIGQKLLTGKTPEGPLPFAVKPAEKVGVRDVMNILRNHHEGTPYDKTEGYRTSPHWTDERVICTSTTHESSVTQLRDNVPAALKAVY… |
| A0A7X8ZRV6 | 44-159 | WVLQRFFNQNSNVWDGPNADYTPLSNDIPWSRKPDKKITSEEVKYALSNHFQETPYDAYSKRADLKLKNSYRSIGINRTSTLGLVQL… |
| A0A0R2B0Q0 | 62-185 | None |
| A0A7J6TXV6 | 141-282 | None |
| U2JDP4 | 55-180 | None |
| D4YSJ6 | 98-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.