DPCstruct | MC5558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 95 ± 7 aa |
| Standard deviation of domain lengths | 6.93 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 35.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0NWI6 | 72-171 | DTGAQRAIYCRLFVLQGALAYHRGDLHDARSLLNRSEGLRRELTLTADDDEKVAQLLSMGFDSRTARAALLACGKDVLRAAACIVEK… |
| A0A811X6C8 | 1-108 | MGYDGRTVVDGSHQRVLFMRLSLLQGIVAYHQNKRDEARRFLQSAEDDLNALRVDPSALLSLQELGWSAGAARGALRATAGDAPRAH… |
| D2W0Q1 | 291-389 | None |
| A0A6P5XKT7 | 166-254 | None |
| A0A820WD78 | 334-421 | None |
| A0A484MHK0 | 1-107 | None |
| A0A6F9CMU1 | 748-835 | None |
| A0A182SK37 | 99-188 | None |
| A0A8B6DG10 | 28-128 | None |
| A0A287JIM2 | 77-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.