DPCstruct | MC5557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 86 ± 10 aa |
| Standard deviation of domain lengths | 9.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0539 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A811X4N7 | 1-95 | MARVTLPGRVETIGDSFLKFAITAYLYCAQPIVHEGKLSHLRSKQVSNLNLYRLGRNKRLGARMIASKFEPHDNWLPPCHKPPATRD… |
| A0A060WBL8 | 486-558 | RLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYV |
| A0A815XTC8 | 62-134 | None |
| A0A6N2AN17 | 28-114 | None |
| H2YYK3 | 1126-1198 | None |
| A0A0N4XP02 | 8-104 | None |
| A0A2A4JF34 | 76-173 | None |
| E9J297 | 1-86 | None |
| A0A2G8JRZ5 | 139-235 | None |
| A0A060Z8U3 | 65-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.