DPCstruct | MC55564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 308 |
|---|---|
| Mean domain length (aa) | 148 ± 28 aa |
| Standard deviation of domain lengths | 27.61 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.76 |
| Pfam Score | 98.80 |
| Assigned Pfam label(s) | CL0007- PF11799- PF00817- CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A392MCE8 | 2-140 | DAFYAAVETLSNPTLKGKPMAVGSMSMISTANYEARKFGVRSAMPGFIARKLCPELIFVPVDFNKYNYYSDLTRKVFQRYDPNFIAG… |
| Q847G6 | 6-141 | RRPVFSLVDANKFYCSCERIFRPELRGKPVVVLSNSDGCIVACTNEAKELGLKMGDPYFKIRAFLERNGVAAFSSNYTLYGELSHRM… |
| A0A1H3Z9Q6 | 11-126 | None |
| A0A3S4JY19 | 1-154 | None |
| A0A2S4KZV1 | 269-430 | None |
| A0A0D3GK68 | 356-517 | None |
| A0A4Q0J139 | 2-148 | None |
| A0A226F3S6 | 9-178 | None |
| A0A0D8XBS3 | 322-434 | None |
| A0A2G8L9J5 | 20-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.