DPCstruct | MC55563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 7.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M5AS49 | 1-100 | MRCKRQDLTSDEIQLHLNTGKVVTQLSLAWQDKLSFVLDDKLVVKRLKFEDLLQDQAEQDGGDEALGQLDASFTLMMLTFGEFLPEL… |
| W7WPL2 | 35-126 | RHNLATDEVRKHIIEGKLPTRLAMSWEGRIGFVLTESMQLKKLAFLEGVFDDRAADGESGFDTDVALSTGELNKLIPELIEALGGEI… |
| A0A0B8PRB5 | 1-75 | None |
| A0A154TQ27 | 126-216 | None |
| A0A1Q9BX98 | 390-484 | None |
| A0A1V5FLG4 | 58-152 | None |
| I3UBL8 | 157-250 | None |
| A0A1G3JAH0 | 42-124 | None |
| A0A4U0PZR7 | 297-381 | None |
| A0A447TDM7 | 32-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.