DPCstruct | MC5555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 183 ± 17 aa |
| Standard deviation of domain lengths | 17.29 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B2ZZ14 | 37-217 | KYYLLVVIGELVTDEHLKCAIADIEKGIRSWDTNLIDCNLDQELKLFVSRHSARFSADVRGQKILHHKSNVLETVVLINPSDEAVST… |
| A0A811X402 | 1-181 | MVLQLILQLQAVGLLSWDSGEHQVDLERELAALTAQAPEGEEARYGERLIQFASENLVTEILIHPQMNTLMQCMRNLLSSFTRHRHL… |
| A0A7J7Y0P4 | 36-216 | None |
| A0A816BKB9 | 15-178 | None |
| A0A7R8CK65 | 18-181 | None |
| A0A140LGY7 | 37-215 | None |
| A0A183RDN6 | 1-214 | None |
| A0A0R4ISC3 | 27-207 | None |
| A0A4W3HLQ0 | 4-160 | None |
| A0A2I4AI08 | 18-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.