DPCstruct | MC55547
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 103 ± 10 aa |
| Standard deviation of domain lengths | 10.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3H9N5 | 2-110 | LADFPVVWDQLRLDVQMLMRSGVGHPGAVELLDLNRVVHSQFPLDPLLGILARMMFWNKLDETPWTKHVPRRYFRAARAKLDDLLED… |
| A0A6G0QRW9 | 1-91 | MWDDLRLDVQRLMCSGVFLKGAVSWLLEDRPVHTRFCQDDLVEMLSRMMFWNKLNESHWPKYVPERYYLAAEALLDDMEEQKVQPLF… |
| A0A225W418 | 416-534 | None |
| A0A6A4BED5 | 10-111 | None |
| A0A225WJS7 | 232-333 | None |
| A0A225W3W8 | 119-237 | None |
| A0A225VII3 | 351-456 | None |
| A0A6A3L078 | 219-333 | None |
| A0A225VWV2 | 301-388 | None |
| A0A662XD43 | 618-720 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.