DPCstruct | MC55543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 318 ± 63 aa |
| Standard deviation of domain lengths | 63.09 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 18.21 |
| Pfam Score | 81.90 |
| Assigned Pfam label(s) | PF19985- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4PI00 | 3-218 | SDEEKQLIDKYGDLTGELHTDLHECLGHGSGKLLPGVDPDALKAYGSTIEEARADLFGLYYVADPKLVELKLVPDADAYKAEYYTFL… |
| A0A1G0Y818 | 39-352 | TKGQPGKTSGYIFHEKSLEKEVTRWLQTRTSFNAIMSRYKKYDPNLISLKWPKHYATRFINVTGKAAEGENIFMFFPDVLGLPANTV… |
| A0A179H667 | 680-1045 | None |
| A0A1R0H2A2 | 524-841 | None |
| A0A2N9IF52 | 40-342 | None |
| A0A2G4I3V0 | 298-612 | None |
| A0A354SM20 | 260-577 | None |
| A0A7R9Q1Z3 | 248-650 | None |
| A0A848LL82 | 65-382 | None |
| A0A7C6ESQ4 | 3-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.