DPCstruct | MC55535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 72 ± 11 aa |
| Standard deviation of domain lengths | 11.30 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 94.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W8T2Y3 | 1-59 | MYIASLPGCAKNDGYLKRQLPGFLEGRSRPDFPADHFEVDFVGRATPDDLTELGRAQMG |
| A0A3S4GD34 | 61-136 | HSVAPVENQRGWGNVMYIPAAPMCEKNLAYARKVKAALETGASPADFPREDYETTWEGRFTLRDLNIHGKRALGMD |
| A0A2Y4XPD8 | 207-271 | None |
| W6JX13 | 4-68 | None |
| A0A6J5BSX1 | 20-99 | None |
| A0A420MHH6 | 155-241 | None |
| A0A0C2YE98 | 147-229 | None |
| A0A4Y8CVL8 | 1-72 | None |
| A0A822CXG7 | 50-137 | None |
| A0A7R7WB43 | 2-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.