DPCstruct | MC55531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 132 ± 18 aa |
| Standard deviation of domain lengths | 17.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 51.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9SMQ2 | 1-118 | VGVFWDLDNKPPKGVAPYKAAISLRDLASEFGLVVDMVAYANHHAFTYVPQWIRDERQERKRLSVLEEQGAVKPEEPYICQFCGRKC… |
| A0A7J6XBQ3 | 35-150 | SLPKTAGNVAVLWDLDNKPPNSIPPFNGAIKLKKAASSFGFVRYMVAYANHHAFRYVLPVVKEQRKKVIQLENKRVIKSPNPHVCRV… |
| A0A5E4G8H6 | 17-137 | None |
| A0A4D9C1Q3 | 8-131 | None |
| A0A6A3CDD4 | 8-132 | None |
| A0A6V7PAH8 | 324-446 | None |
| A0A445ADM3 | 18-138 | None |
| A0A835DNH5 | 226-392 | None |
| A0A7J6WZ71 | 3-132 | None |
| A0A498HMR4 | 127-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.