DPCstruct | MC55527
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 140 ± 26 aa |
| Standard deviation of domain lengths | 25.52 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.76 |
| Pfam Score | 84.62 |
| Assigned Pfam label(s) | PF09371- CL0580 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W1I585 | 103-220 | HGMLTAKVVKGKEEEAAKYRDYFDCNEPLKRCSSHRLLAIRRGEAEGLLKVGITPDDEACMERLDRQFVRSDNECGQQVAEAVQDAY… |
| Q7P278 | 217-341 | RERIREIYLKYSIIESKASKKAAELDEKKVYNDYYEYSEKVEKMPSHRILALNRGEKEDILTVHLRLEDSDRERIENMILKEFPKND… |
| A0A484YAJ4 | 8-141 | None |
| A0A377BXS9 | 14-184 | None |
| A0A3Q0IV34 | 509-642 | None |
| A0A6D0LZT0 | 8-143 | None |
| A0A447N2R9 | 2-143 | None |
| A0A813FLV0 | 313-443 | None |
| A0A4U9D1T2 | 3-138 | None |
| A0A4C1VWB2 | 100-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.