DPCstruct | MC55526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 102 |
|---|---|
| Mean domain length (aa) | 211 ± 34 aa |
| Standard deviation of domain lengths | 33.83 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.20 |
| Pfam Score | 72.71 |
| Assigned Pfam label(s) | PF13351- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J7I1H9 | 54-296 | YPNCEMSIPKKIKGKNIPEEQIKKLFKDKKTDLIKGFESEKGKFDAYLAFHEGRVRLALPTIDELSLGRCPKCQKGKILSKEKFYGC… |
| A0A4Y8WMX6 | 12-252 | AELPWGLMAYNGVDVEWLRNQRELVDSLCRGEETHKVPIYMREQFSSEEIDEMKANGRKIPGMNERNMVEGTMRVYIRRDSNEVSAI… |
| H1YHH5 | 308-574 | None |
| A0A0A7LQE7 | 499-713 | None |
| K2P2D7 | 1-244 | None |
| A0A519M8Q3 | 648-840 | None |
| A0A1M6S8M9 | 10-189 | None |
| A0A5B2U9E9 | 3-204 | None |
| A0A4S4A4T8 | 93-356 | None |
| A0A2N2ZTK7 | 9-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.