DPCstruct | MC55522
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Standard deviation of domain lengths | 7.74 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2USU5 | 1-84 | MENSVVNDEAIFNVYAPNTKFKKKSPGNPDYRIAIRSSELDIPLDMNSLCSSQENTNLIQAVVTPNGSLSFFQFSRINLPTDLR |
| A0A5B6Z5W6 | 48-116 | FDVYPPNSKFKKSSPGNPSFVLCLPGGHPPSKPEIEDLERQCNGIPLKFCYVEYGRVSFFSFNKVELPA |
| A0A819KWJ1 | 222-294 | None |
| A0A6P7U5Y9 | 533-614 | None |
| A0A453L7I3 | 112-177 | None |
| B9SMU1 | 183-259 | None |
| F0ZY11 | 108-179 | None |
| S4NTX1 | 65-150 | None |
| A0A7J7J4F8 | 1-82 | None |
| A0A1J6IQZ7 | 405-471 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.