DPCstruct | MC55520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 122 ± 25 aa |
| Standard deviation of domain lengths | 25.28 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 69.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.58 |
| Pfam Score | 70.59 |
| Assigned Pfam label(s) | CL0023- PF14510 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P5Y5A6 | 5-96 | GVEVAELERRMDDDEVELQWAAIERLPTVKRIRTSLFDQKLLNAGKDEDLGMKVIDVTQLRALERRGFIDHLITVIDKDHLNLLNRL… |
| A0A7J6EG55 | 1-96 | MWNSAENVFVRSSSFRENGEDKEALRWAALERLPTYKRVRRGIFKDVVGDTKEVDVNELESSEQKLLLERLVNAVEDDPGRFFDRMR… |
| A0A1E5UPX5 | 26-154 | None |
| A2YUT7 | 9-126 | None |
| A0A0E0MGQ1 | 8-160 | None |
| A0A2G2X7C9 | 225-390 | None |
| A0A7J0FUK7 | 95-203 | None |
| A0A0P0VJX8 | 27-192 | None |
| A0A834LX63 | 5-107 | None |
| A0A834LUC5 | 11-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.