DPCstruct | MC55517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 116 ± 13 aa |
| Standard deviation of domain lengths | 12.68 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 49.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0048 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9J3V5 | 29-142 | SSAHYILQQYIAATGVQKLQSSIKNAYAMGKLKMVACEYETATRIVKSCNVSRGAESGWFVLWQMNPDMWYVELAVNGCKVHAGCNG… |
| A0A314XZP2 | 10-118 | TAKYIVQQYTAATGGQAALNSVNSMCVTGEVKISASDFQQGDVSLEVKRSSAESGGFLLWQKNPDLWCLELVVSGCKVICGSNGKLS… |
| A0A843WPE4 | 113-201 | None |
| A0A4D6MB17 | 284-424 | None |
| A0A2R6PAM5 | 449-561 | None |
| R0HGK1 | 79-189 | None |
| A0A5C7ITC0 | 43-160 | None |
| M7Y7Z0 | 5-121 | None |
| A0A843VVK0 | 82-213 | None |
| A0A834H8C0 | 85-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.