DPCstruct | MC55515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 441 ± 97 aa |
| Standard deviation of domain lengths | 96.73 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 77.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.47 |
| Pfam Score | 98.91 |
| Assigned Pfam label(s) | CL0172- PF04161 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0WZ54 | 105-643 | LLTMLTGLWLFSSVKADSKAITTSLTTKWFSTPLLLEASEFLAEDSQEKFWDFVEASQNVGSSDHHGTDYSYYHAILEAAFQFLSPL… |
| A0A1Y2ERU0 | 10-627 | SAFVLPALADSQATPQLSVRVDSNEHASHLIPRFLECVAAEKPSALHPFLSFLTANKVKPTITLSAPEFEVKTGLNGKKQKSKYTQH… |
| A0A3P7D5V2 | 7-345 | None |
| A0A2I0TLV2 | 13-332 | None |
| A0A5D3DFV5 | 1-275 | None |
| E7F6G9 | 26-514 | None |
| A0A5J5S222 | 23-595 | None |
| K5UIR7 | 8-412 | None |
| A0A673HYV4 | 23-424 | None |
| A0A067PM13 | 4-508 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.