DPCstruct | MC5551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 110 ± 20 aa |
| Standard deviation of domain lengths | 20.20 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8NK22 | 1-60 | MDGMERFACPTPDVQGRYRCIDDHVLCDGFIDCPEGEDEDRRSCMFYKTTKAHLDVLADA |
| A0A811WYF9 | 4-110 | PSSSRTEVNRGRGTQSAHVGSLSPVAKNRRYDKVAERLQCPPAADGMERFACPTPDRQGRYRCIDDHVLCDGFIDCPNGEDEDRQAC… |
| A0A0K0E7G3 | 44-147 | None |
| A0A6B2EAQ3 | 111-238 | None |
| A0A3P7JDY1 | 17-115 | None |
| A0A183J7E4 | 1-87 | None |
| A0A2H2IIL4 | 6-138 | None |
| A0A2A6CUY9 | 1-132 | None |
| A0A139WN15 | 43-153 | None |
| A0A482WGK6 | 156-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.