DPCstruct | MC55507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 166 ± 28 aa |
| Standard deviation of domain lengths | 27.62 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0242 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2ASP3 | 8-170 | LRSRHRLSHYARLYYSLFLKEVGMELEDSIIFWRQEYSKPHTCSSVCLHNWQSNEKKFIYSIRHMYGLEGSRRNYKTPDCNLICAGI… |
| A0A0M3JIH1 | 1-95 | MRQIHTRLRVDHHLMHSARMQYGLFLKAIGMTLEDALAFFRAEFTKKVDSDKFDKQYAYNIRHNYGKEGSRRDYKAYSCAKIILGDA… |
| A0A7M7N3F0 | 291-465 | None |
| A0A6A6KVD2 | 388-584 | None |
| A0A0C9RT23 | 45-241 | None |
| A0A7N2L8B6 | 201-342 | None |
| A0A7N2KTL0 | 798-971 | None |
| H2WKC1 | 43-240 | None |
| A0A6V7Y785 | 42-214 | None |
| A0A0V0T7X6 | 286-477 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.