DPCstruct | MC555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Standard deviation of domain lengths | 4.96 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0THB4 | 313-376 | SDQVCETDADCVPAECCHASACTAAGAAPSCDDVACTADCQEGTLDCGGRCLCLQGRCAAYLSQ |
| A0A256XY71 | 95-161 | KEEEKLEKCKTDADCAPAECCHATKCVLKSKAPNCEGIMCTMECRQGTLDCGGRCKCIEGTCKPEIN |
| A0A3M0Y439 | 40-110 | None |
| A0A0S4JKT5 | 17-85 | None |
| A0A0S4JLG6 | 18-87 | None |
| A0A0S4JN02 | 68-137 | None |
| A0A4U1ILL9 | 47-121 | None |
| A0A2H6H213 | 2-62 | None |
| A0A0C2CZT7 | 45-114 | None |
| A0A2H9PT09 | 5-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.