DPCstruct | MC5549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 102 ± 11 aa |
| Standard deviation of domain lengths | 11.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 29.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y9K9L3 | 27-131 | NPANWEPVDERSMSKDREGEFLKRKGAIQAYMDGMSNTDLKKTWGLGRSYISQLVGRCLEEHADGKLWGWRGAIPHIRVKEWTRKTR… |
| A0A151QJS6 | 18-106 | ADFTIWPGFDEASLAPDKLAKFLNRKEAIKAYLSGSKVAAIRKEYGISEPQIYRLITERCICDHPDGQIYGWRALVPQSRIVQFKRR… |
| A0A375CR14 | 21-109 | None |
| A0A1A7BYH8 | 8-112 | None |
| A0A4Y8MJM7 | 14-119 | None |
| A0A6G3ZXB9 | 1-127 | None |
| A0A2N6IBK9 | 11-120 | None |
| A0A416JGJ0 | 4-106 | None |
| A0A1Y0FLQ8 | 1-106 | None |
| A0A854ZR95 | 6-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.