DPCstruct | MC55486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 317 |
|---|---|
| Mean domain length (aa) | 218 ± 47 aa |
| Standard deviation of domain lengths | 46.54 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 13.17 |
| Pfam Score | 44.19 |
| Assigned Pfam label(s) | PF12294- PF11185- CL0184- CL0113- PF06128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y5TJJ6 | 4-231 | RFIFRQVYFGDLPTFLADGEIRAKNHGSPQLCHQTSYQEIVNRRGTNEFPMPCGGVVNDYVPFYFSPLTSFTYAIHSGNVPLISPSG… |
| A0A8A3TVN6 | 28-235 | SFTYEELNFIFDIFKKGRIRKIENIKFLYYIVPIENLENIIKSGKIECRNNVLKKGKRINDPSDKNVQKRRAEKYIYRKYNIHNFVG… |
| A0A0N0ARP3 | 3-201 | None |
| A0A812LMA8 | 180-400 | None |
| A0A359LUB1 | 6-172 | None |
| A0A1X9SM09 | 7-192 | None |
| A0A7W8XIZ1 | 68-307 | None |
| A0A349MFN0 | 27-249 | None |
| U1GZ84 | 13-209 | None |
| A0A1C5MM23 | 292-501 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.