DPCstruct | MC55481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 80 ± 14 aa |
| Standard deviation of domain lengths | 14.18 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212PI59 | 37-112 | MHPALSLLILVAVAVAVNLPLGYLRQNYEKFTFGWYFYVHISIPLIIYMRIKSGFGWKIIPLTLGGAVVGQILGGI |
| A0A7V5V8S1 | 1-76 | MNTFLVLIAITAFALLLNLPFGYLRSGTRKFSLLWMLYIHIPIPFIFILRKMGGLDFTFVPVIAVGAVAGQFLGGR |
| A0A5N5IB63 | 514-596 | None |
| A0A522UPN9 | 3-73 | None |
| A0A351RWB2 | 7-81 | None |
| A0A7V4JDR5 | 2-73 | None |
| A0A1G0RH69 | 1-75 | None |
| A0A0E9NS40 | 298-379 | None |
| A0A2N6EQ54 | 3-81 | None |
| A0A2H0LEP1 | 28-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.