DPCstruct | MC55477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 219 ± 54 aa |
| Standard deviation of domain lengths | 53.96 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 80.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A6G189 | 224-435 | HVIYAIEAEHDRTEPIHSKFTGRCQAVRVTLPQRKPSASAFIGTWLGTIEAKDHLLFSVEEVVNAYDDEFGSEPTVGHVELISGARF… |
| A0A179GY64 | 28-265 | NRMLSAETRERSRLAQAWYHVDAVDYLERGHAELGLRGKLDNYLRSQGADPAEFPHAYLLTAARFLGYHFNPVSFWYLYSADKILTA… |
| A0A1L7VS37 | 111-399 | None |
| A0A2E2YRC3 | 34-237 | None |
| A0A812K5P9 | 51-261 | None |
| A0A177WIM2 | 22-292 | None |
| A0A7X7R7C9 | 1-128 | None |
| A0A2V1DJH0 | 51-282 | None |
| A0A3N4IG94 | 161-413 | None |
| A0A850QXM2 | 1-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.