DPCstruct | MC5547
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 381 ± 87 aa |
| Standard deviation of domain lengths | 86.93 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 73.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 21.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060T6I9 | 4-276 | VEHLISHSNHLSQRLQMLLDKQWDALSVSGTPKHTRKLIESTMNELLDTQKELVECYDSELTIKREWLDKTKVIQDKIVRLQQEITS… |
| S8B7C0 | 1-440 | MSIILPLRGNRLSALPAASSASIRDPLSQIERQADLIQKILQELIDAQSEGLAVGLGQPSLEDTLDCSTTRAPVSALRAGSLSKAPG… |
| A0A225ALL2 | 5-380 | None |
| B6K3R8 | 43-336 | None |
| A0A0F4YN41 | 2-432 | None |
| A0A6A5TAH7 | 39-496 | None |
| A0A2T0FLL7 | 2-241 | None |
| A0A5J5F7B6 | 31-385 | None |
| M7T3E0 | 135-676 | None |
| A0A1V2LTM1 | 2-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.