DPCstruct | MC55463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 334 ± 21 aa |
| Standard deviation of domain lengths | 21.33 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 33.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K2J9Q9 | 1-341 | MADGRVRPCPARDLPGLLEWTLRAPLGAAPIRAEGLPSGPLLVLTSTALDRLGLPAEAPDQAHRHPHSDHILLRQLRSIGWQSDDHG… |
| A0A4D4KN51 | 240-564 | PAKSLPALVEWTLAEARLGAPRLNRNGRDADPVLVLTDAAAMRFGLPARLTDEERRAGRLSEGHKVLKQLEKADWRLTRRGLGPWAR… |
| A0A1Y5LDL1 | 281-581 | None |
| A0A2S2C7W5 | 123-423 | None |
| A0A1D7Y291 | 14-339 | None |
| A0A3M8EXJ1 | 577-911 | None |
| A0A8A6HYV1 | 310-643 | None |
| A0A559TQI8 | 141-506 | None |
| A0A062VJK6 | 247-562 | None |
| A0A2X0KGA2 | 165-503 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.