DPCstruct | MC5546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 144 ± 20 aa |
| Standard deviation of domain lengths | 19.91 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S9HXE4 | 19-148 | WAKEDAQGNCPQAGPETEQFSLGSCIFNIRYGHPPYAELESPVWYEYMSHQRYPPTPKGDDIGDIIQACWRGDYASIEQLEDHISLV… |
| A0A428R7J3 | 439-565 | WARVLGSEAGAQRGTFGINGLQTEQFAIGSLLFTMSRGYEPYAELEPGPHIVDLLQDMKFPDLGHGYLDTIIDACWKGLYGSVESLA… |
| F2S3I6 | 175-356 | None |
| A0A2S4L4I6 | 1-142 | None |
| A0A507B5U3 | 1091-1227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.