DPCstruct | MC55456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 101 ± 18 aa |
| Standard deviation of domain lengths | 18.20 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 33.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519Z3B2 | 2-98 | RVRWWQNPATATYDTYYLEDLAELRGQPVELTKLLDPWYYQDETPVFFGHYWLKGAPTLLQPHAACLDYSVARGGQLVGYRWDGEQV… |
| A0A3C1PWR5 | 47-151 | FRDYFGVKRNRIRLNWWQSQQTTFREAAVIDDSQRHSIPELPLPEKPPTYDGPLCFFGHYWMRGTPQIIHPKAICLDYSVALKDGAL… |
| A0A7Y3QIT2 | 21-134 | None |
| A0A8A7DPD8 | 1-114 | None |
| A0A7I7K3M5 | 215-332 | None |
| A0A2M7Y995 | 94-216 | None |
| A0A1B8P5E6 | 4-88 | None |
| A0A1E4NRQ2 | 30-125 | None |
| A0A2G2GM96 | 1-99 | None |
| A0A6M4XRU2 | 139-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.