DPCstruct | MC55452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 474 |
|---|---|
| Mean domain length (aa) | 158 ± 24 aa |
| Standard deviation of domain lengths | 24.32 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.21 |
| Pfam Score | 69.97 |
| Assigned Pfam label(s) | CL0125- PF20174- PF16044- PF12597- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0LF70 | 9-177 | RETQRAVFLVTTPISFGVLEVSQSSYKLLARHVGMSLNSVSHWAVCVIDRGLGKCYCYDLMSDRLELTMLGKNYFRVAVITEEFVET… |
| M3BB79 | 2-100 | EIELYVYDLTRGMARAMSRQFLGVQIDAVYHTALVFGGIEYFFGAGVQTCYPGTTHHGQPMEVIKLGTTQLPLEIILEYLESLKEVY… |
| A0A7S4PJL5 | 102-257 | None |
| A0A7S4RMQ5 | 19-184 | None |
| G3J5Y4 | 11-171 | None |
| A0A7S4R0N5 | 205-367 | None |
| A0A2B4S185 | 105-282 | None |
| E9FR33 | 18-225 | None |
| A0A199VYN1 | 2-97 | None |
| A0A061QP73 | 2-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.