DPCstruct | MC55450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 156 |
|---|---|
| Mean domain length (aa) | 341 ± 53 aa |
| Standard deviation of domain lengths | 52.73 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 13.69 |
| Pfam Score | 74.29 |
| Assigned Pfam label(s) | PF12449- PF06985- CL0084 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7WRE0 | 54-312 | RDLDLVDPDRWREALTVLAADPAVAPLLADRDGYTAWWLRGNVVLAGRPIAVLRAPGDPTFAGLLDAVEHPAASALTGLLAGARVES… |
| X0L4L8 | 32-354 | VSDCFWSESDTTELNSSLKRCYPDLKDFFLDKLGVKGSAYDYLLSTTSKEPHDVKMAVLSFMEEVGDFVPRFPAKPVRTAKILPVRC… |
| A0A2R7S3B6 | 153-525 | None |
| A0A167MX35 | 421-831 | None |
| A0A0D2HVQ7 | 2-309 | None |
| A0A1D1YMP8 | 34-434 | None |
| G2YWV7 | 25-197 | None |
| G2YWV6 | 351-639 | None |
| A0A813VKB0 | 329-617 | None |
| A0A897NUG5 | 26-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.