DPCstruct | MC5545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 134 ± 12 aa |
| Standard deviation of domain lengths | 12.31 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S8B0I4 | 2-132 | NHDGPSTAEIAAIKRRCATSLLAVIPRSVARKLFGVVLSPQDDRTYSNKSSEGNTESLSSFNAGDSSSSATPDEESEEAHLLHAIEE… |
| A0A2A9NWN7 | 2-104 | FPNNAPGPSSLSPPTSEAELRALRRRAASALWSLVPSAAAGRVYLAARSDADAIDQVDESLLVLGDVYCNKHLLYATLELLFVRLMP… |
| A0A2T3ZNT8 | 97-235 | None |
| W9XLX2 | 115-258 | None |
| F0XPT4 | 2-127 | None |
| A0A6G1GEB8 | 6-133 | None |
| A0A0F8V2N5 | 91-242 | None |
| A0A1J9R702 | 5-144 | None |
| A0A194V7F2 | 1-115 | None |
| A0A2U3EK02 | 886-1028 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.