DPCstruct | MC55441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 113 ± 9 aa |
| Standard deviation of domain lengths | 9.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T6Z9R2 | 99-210 | TVEYSKISTPYQQGLIYSQSYSPLKCLFDAAGCYPLQNSSLEYLSLTPELIKSWQASGPSGRGISLDIDKLKTAYIHSRDRILSSLQ… |
| X0KGS5 | 206-313 | TIETGKRSQRRAAGLLYSQFYSSVKEVFAAGNVYPFTNAAIETLALDKKLRKTWELVGGGLSHQPTALIKAYLYTKLRCHHAILGSM… |
| A0A0J6FC93 | 477-589 | None |
| A0A2V1D3U1 | 104-210 | None |
| A0A3N4IXJ9 | 319-430 | None |
| A0A3N4IZG4 | 531-637 | None |
| A0A2T6ZA87 | 665-785 | None |
| A0A3N4IXA4 | 307-413 | None |
| A0A2K0W1K7 | 1-130 | None |
| A0A2V1CZ63 | 155-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.