DPCstruct | MC5544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 174 ± 29 aa |
| Standard deviation of domain lengths | 29.37 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 69.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 34.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05234 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3M0D9 | 1-126 | RNREGNLYDAVAGRLGAEGFLGDNNRGLKPLRPDEVLYSRAGAPVRYEEDDEYTQHRHLPPDALPSSDLLKAIHAYVSDYYGSGHLG… |
| S8AW71 | 14-207 | LSVPTEDETDAVESEYSYKQIRRTTNVYDAVAGRVNRKGHHPNEAFASRYRDTASSGARSLRPEEVLFRAQNNLIDFDEKEYFAHER… |
| A0A2I0S743 | 221-376 | None |
| A0A2H1GPK4 | 170-381 | None |
| A0A2D3V3P7 | 76-258 | None |
| A0A167D986 | 42-279 | None |
| A0A6A5V660 | 4-150 | None |
| A0A2T7A197 | 27-176 | None |
| A0A6A5K5F4 | 1-179 | None |
| A0A6A6BH64 | 1-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.