DPCstruct | MC55433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 192 ± 12 aa |
| Standard deviation of domain lengths | 11.95 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5RNE9 | 6-183 | FQLHRFSPYFFDAPNYGIQQVRPAWGYRFAYPGLNEQELAQVAYCFEFNSAAMEPPRPALESLFAAASDWMSAGSRHSNLCLMQTAD… |
| A0A166IL02 | 15-205 | QSAATIRLDRFSPNFDESEKFGFVKVEPYPSYYYIYPLADEAVANLAYYFTFKYKEPQDTQTYTQPVLEKIAVWRKEYETSDLFMVD… |
| A0A2P9HZF7 | 950-1147 | None |
| A0A1Q7AK92 | 654-830 | None |
| A0A3C1ZY71 | 28-207 | None |
| A0A7W1K822 | 224-411 | None |
| A0A351CEG1 | 2-192 | None |
| A0A3G2J6I9 | 1-190 | None |
| A0A1M4DVQ0 | 526-722 | None |
| A0A7X6WL42 | 41-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.