DPCstruct | MC55432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 54 ± 7 aa |
| Standard deviation of domain lengths | 7.26 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 61.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0516 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5I1H0 | 1-45 | FLCPCHGSTFDMAGRVYKNKPSPDNLEVPPHVYLSDTRLLIGDDK |
| A0A6P0G5F4 | 1-52 | WKGGYFCPCHKSRFDMSGRVFDGVPAPINLLVPPHHYVDDNTLVIGVDPDDA |
| A0A6A5KWP9 | 341-394 | None |
| A7C6F3 | 2-54 | None |
| A0A7C5CN80 | 21-76 | None |
| A0A7C3JNN7 | 48-96 | None |
| A0A1A8Y119 | 12-54 | None |
| A0A2M7Q2W4 | 54-123 | None |
| A0A0H3YX38 | 7-59 | None |
| U7P7X0 | 7-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.