DPCstruct | MC55430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 415 ± 66 aa |
| Standard deviation of domain lengths | 65.97 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2K252 | 119-526 | MKGMEMNHSAKKMPPSHSRSMKMANTSKKTVKAKHHKQMTMEPGQSVIKEAGSGRSLPPWGKRFSYDFSLLSTDVSSNPRRAMDGGP… |
| A0A432RJS2 | 233-544 | YSRLRSPVSTRLPSTKAVTEYRLVLQGDMERYVWTINGKILNESDEIRIRRGENVRFVLINKSMMHHPMHLHGHFFRMVNEHGDYSP… |
| A0A7Y2ZYW4 | 56-468 | None |
| A0A4Z0EJU0 | 749-1150 | None |
| A0A7Y0AFW9 | 79-656 | None |
| A0A380CJ88 | 1-402 | None |
| A0A518D0R0 | 402-720 | None |
| A0A7C8HWH9 | 323-706 | None |
| A0A4Q2XSS4 | 4-427 | None |
| A0A7M1T4J6 | 120-548 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.