DPCstruct | MC5543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 323 ± 37 aa |
| Standard deviation of domain lengths | 37.16 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9GK34 | 1-279 | MRHPWGVLDYHMYLSHIESGRDKLHREKECHLIGTTGFRQVTLHDEPVLDNIPSGRNPTVVFVGLPVPDMQNESSNARLVLGFDLKS… |
| S7ZMH6 | 5-358 | HFTTFQDKLSLTQELPVNYQKCVHPMDIISTSHEPNPLRRSRCEGDSLAYDAFWASRHPWDLIDYYLYLILIEKGVHRRETRLFRSW… |
| A0A507QXS2 | 46-418 | None |
| A0A1V6NRB8 | 23-298 | None |
| A0A1V6ST79 | 1-347 | None |
| A0A0F4YYT4 | 46-455 | None |
| A0A0F7TUP0 | 1-347 | None |
| B8MWF0 | 2-301 | None |
| A0A1V6Q667 | 20-320 | None |
| A0A2G7FRE6 | 487-846 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.