DPCstruct | MC55424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 170 ± 15 aa |
| Standard deviation of domain lengths | 15.49 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 37.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B6GZS5 | 1-171 | MSMDGKTPDLLPLSAAKKKVLDDVHVALACVYALHNALAIVFSTAVGYIAVDYFDVSCSQLSSILPCVELTDAESAWLAALSIGILC… |
| T1NRT8 | 1-166 | GKTPHLLPVSVSMSVTVANKTPDAVRQVMAWALLNAFVFVVSYAMGYAIDYALHHYHVSCSKFSFILRCDQLTDAERNHWIVILSCA… |
| A0A5J9SKS1 | 95-269 | None |
| A0A5J9SKT4 | 1-181 | None |
| A0A1E5UIL6 | 1-136 | None |
| A0A5J9UUV8 | 390-554 | None |
| A0A5J9UTS2 | 53-222 | None |
| T1ML21 | 5-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.