DPCstruct | MC55419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 169 ± 22 aa |
| Standard deviation of domain lengths | 22.04 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A017T1M7 | 197-357 | AHMEVLARDLRLTDPNAERLKRIAASYYKATRKRLVVTGGYRPPQRQAELMVDKLKRGEDIVLLYENKAAVGEIRAAYRAGVAQEHT… |
| A0A7Y0QRW6 | 444-632 | GKTKNVSVDKDFVPAIIFSSKIPEDLKNIVSNKSLDIMKEIMKSSGVHKITITSTLRTVQKQVVAMYDNMRSKGIQSQLDYYAAPGR… |
| A0A7V9GAG7 | 395-547 | None |
| A0A3B0Z9Q9 | 6-157 | None |
| A0A3D3MPF1 | 58-223 | None |
| A0A158A2N4 | 12-201 | None |
| A0A559QLB7 | 109-301 | None |
| A0A1I4A325 | 354-518 | None |
| A0A4S2FT93 | 169-343 | None |
| A0A7X7DKY4 | 246-426 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.