DPCstruct | MC55418
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 88 ± 22 aa |
| Standard deviation of domain lengths | 21.65 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 80.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 37.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y0MQ31 | 1-87 | MYAKSFIALDGNGRLTGARIAQTAPYDRYTCHHCGSALQYQPGYDTERPWFAHRHGDLTENGRQHCPYVNPDSGERQLARRLQHFLP |
| A0A6G2GFF2 | 1-71 | MRILNCYMANDSKGHFVTAKDAAKHNRQDVLCCVSCGCPLTLKRGNDGQPPWFEHDQMTVAEKILLRCTWL |
| A0A377KBK0 | 1-86 | None |
| A0A330D4E6 | 2-105 | None |
| A0A654DK61 | 4-128 | None |
| A0A735VZ17 | 1-113 | None |
| A0A7X4NGH5 | 1-71 | None |
| A0A377DLS2 | 1-57 | None |
| I2WR66 | 1-68 | None |
| A0A0T9UH82 | 44-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.